Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Immunology
Uniprot ID: P60033
Gene Names: CD81
Organism: Homo sapiens (Human)
AA Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Expression Region: 113-201aa
Sequence Info: Extracellular Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 11.8 kDa
Alternative Name(s): 26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28 ;Tspan-28; CD81
Relevance: May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-KDA Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.
Reference: TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.