Skip to product information
1 of 1

GeneBio Systems

Recombinant Human CD70 antigen (CD70), partial (Active)

Recombinant Human CD70 antigen (CD70), partial (Active)

SKU:P32970

Regular price $584.80 CAD
Regular price Sale price $584.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: P32970

Gene Names: CD70

Alternative Name(s): (CD27 ligand)(CD27-L)(CD27L)(CD27LG)(TNFSF7)

Abbreviation: Recombinant Human CD70 protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 52-193aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged

Target Protein Sequence: SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

MW: 22.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: ①Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 μg/mL can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport.

Reference: "A clinicopathological study on the expression of cadherin-17 and caudal-related homeobox transcription factor (CDX2) in human gastric carcinoma." Ge J., Chen Z., Wu S., Yuan W., Hu B., Chen Z. Clin Oncol (R Coll Radiol) 20: 275-283(2008)

Function:

View full details