Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human CD63 antigen(CD63)

Recombinant Human CD63 antigen(CD63)

SKU:CSB-CF004950HU

Regular price $2,219.00 CAD
Regular price Sale price $2,219.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P08962

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Protein Names:Recommended name: CD63 antigenAlternative name(s): Granulophysin Lysosomal-associated membrane protein 3 Short name= LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30 Short name= Tspan-30 CD_antigen= CD63

Gene Names:Name:CD63Synonyms:MLA1, TSPAN30

Expression Region:2-238

Sequence Info:full length protein

View full details