Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Immunology
Uniprot ID: P09326
Gene Names: CD48
Organism: Homo sapiens (Human)
AA Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Expression Region: 27-220aa
Sequence Info: Full Length of Mature Protein
Source: Yeast
Tag Info: N-terminal FC-tagged
MW: 48.3 kDa
Alternative Name(s): B-lymphocyte activation marker BLAST-1 BCM1 surface antigen Leukocyte antigen MEM-102 SLAM family member 2 Short name: SLAMF2 Signaling lymphocytic activation molecule 2 TCT.1 CD_antigen: CD48 BCM1, BLAST1
Relevance: Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
Reference: "The human leucocyte antigen CD48 (MEM-102) is closely related to the activation marker Blast-1." Korinek V., Stefanova I., Angelisova P., Hilbert I., Horejsi V. Immunogenetics 33:108-112(1991)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.