Recombinant Human CD320 antigen(CD320) ,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human CD320 antigen(CD320) ,partial

CSB-RP106044h
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: Q9NPF0

Gene Names: CD320

Organism: Homo sapiens (Human)

AA Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

Expression Region: 36-231aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 47.1 kDa

Alternative Name(s): 8D6 antigenFDC-signaling molecule 8D6 ;FDC-SM-8D6Transcobalamin receptor ;TCblR;; CD320

Relevance: Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.

Reference: Identification of a human follicular dendritic cell molecule that stimulates germinal center B cell growth.Li L., Zhang X., Kovacic S., Long A.J., Bourque K., Wood C.R., Choi Y.S.J. Exp. Med. 191:1077-1084(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share