Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4(CEACAM4),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4(CEACAM4),partial

CSB-YP005164HU
Regular price
$855.20 CAD
Sale price
$855.20 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: O75871

Gene Names: CEACAM4

Organism: Homo sapiens (Human)

AA Sequence: FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG

Expression Region: 36-155aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 14.7 kDa

Alternative Name(s): Carcinoembryonic antigen CGM7Non-specific cross-reacting antigen W236

Relevance: Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

Reference: Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y.J. Biol. Chem. 266:11810-11817(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share