![Recombinant Human Carbonyl reductase [NADPH] 1(CBR1)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_1bda0d88-d2d7-4eec-acbd-d255c58de8cf_{width}x.jpg?v=1659196432)
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Metabolism
Uniprot ID: P16152
Gene Names: CBR1
Organism: Homo sapiens (Human)
AA Sequence: SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Expression Region: 2-277aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 32.2 kDa
Alternative Name(s): 15-hydroxyprostaglandin dehydrogenase [NADP(+)] (EC:1.1.1.197)NADPH-dependent carbonyl reductase 1;Prostaglandin 9-ketoreductaseProstaglandin-E(2) 9-reductase (EC:1.1.1.189)Short chain dehydrogenase/reductase family 21C member 1
Relevance: NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.
Reference: Human carbonyl reductase. Nucleotide sequence analysis of a cDNA and amino acid sequence of the encoded protein.Wermuth B., Bohren K.M., Heinemann G., von Wartburg J.-P., Gabbay K.H.J. Biol. Chem. 263:16185-16188(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.