Gene Bio Systems
Recombinant Human Cancer-testis antigen 1(CTAG1A)
Recombinant Human Cancer-testis antigen 1(CTAG1A)
SKU:CSB-EP006125HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P78358
Gene Names: CTAG1A
Organism: Homo sapiens (Human)
AA Sequence: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Expression Region: 1-180aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 10xHis-tagged
MW: 21.5 kDa
Alternative Name(s): Autoimmunogenic cancer/testis antigen NY-ESO-1 Cancer/testis antigen 6.1
Relevance:
Reference: "A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening." Chen Y.-T., Scanlan M.J., Sahin U., Tuereci O., Gure A.O., Tsang S., Williamson B., Stockert E., Pfreundschuh M., Old L.J. Proc. Natl. Acad. Sci. U.S.A. 94:1914-1918(1997)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
