Gene Bio Systems
Recombinant Human Calcium channel flower homolog(CACFD1)
Recombinant Human Calcium channel flower homolog(CACFD1)
SKU:CSB-CF880082HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9UGQ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAA GVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLT TLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL
Protein Names:Recommended name: Calcium channel flower homolog Alternative name(s): Calcium channel flower domain-containing protein 1
Gene Names:Name:CACFD1 ORF Names:C9orf7, PSEC0107, PSEC0248, UNQ3071/PRO9903
Expression Region:1-172
Sequence Info:full length protein
