Skip to product information
1 of 1

GeneBio Systems

Recombinant Human C-X-C motif chemokine 13 (CXCL13)

Recombinant Human C-X-C motif chemokine 13 (CXCL13)

SKU:O43927

Regular price $712.30 CAD
Regular price Sale price $712.30 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: O43927

Gene Names: CXCL13

Alternative Name(s): (Angie)(B cell-attracting chemokine 1)(BCA-1)(B lymphocyte chemoattractant)(CXC chemokine BLC)(Small-inducible cytokine B13)

Abbreviation: Recombinant Human CXCL13 protein

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 23-109aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

MW: 17.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Antimicrobial peptide which inhibits the growth of a variety of fungi, oomycetes, Gram-positive bacterial phytopatogenes and S.cerevisiae in vitro. No activity against E.coli.

Reference: "MiAMP1, a novel protein from Macadamia integrifolia adopts a Greek key beta-barrel fold unique amongst plant antimicrobial proteins." McManus A.M., Nielsen K.J., Marcus J.P., Harrison S.J., Green J.L., Manners J.M., Craik D.J. J. Mol. Biol. 293: 629-638(1999)

Function:

View full details