Recombinant Human C-X-C motif chemokine 10(CXCL10)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human C-X-C motif chemokine 10(CXCL10)

CSB-YP006240HU
Regular price
$855.20 CAD
Sale price
$855.20 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: P02778

Gene Names: CXCL10

Organism: Homo sapiens (Human)

AA Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Expression Region: 22-98aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 10.6 kDa

Alternative Name(s): 10KDA interferon gamma-induced protein ;Gamma-IP10 ;IP-10Small-inducible cytokine B10

Relevance: Chotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Reference: Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins.Luster A.D., Unkeless J.C., Ravetch J.V.Nature 315:672-676(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share