Recombinant Human C-C motif chemokine 24(CCL24)

Recombinant Human C-C motif chemokine 24(CCL24)

CSB-RP059094h
Regular price
$709.00 CAD
Sale price
$709.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: O00175

Gene Names: CCL24

Organism: Homo sapiens (Human)

AA Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

Expression Region: 27-119aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 14.5 kDa

Alternative Name(s): CK-beta-6Eosinophil chemotactic protein 2Eotaxin-2Myeloid progenitor inhibitory factor 2 ;MPIF-2Small-inducible cytokine A24

Relevance: Chotactic for resting T-lymphocytes, and eosinophils. Has lower chotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hatopoietic progenitor cell line. Binds to CCR3.

Reference: Molecular and functional characterization of two novel human C-C chemokines as inhibitors of two distinct classes of myeloid progenitors.Patel V.P., Kreider B.L., Li Y., Li H., Leung K., Salcedo T., Nardelli B., Pippalla V., Gentz S., Thotakura R., Parmelee D., Gentz R., Garotta G.J. Exp. Med. 185:1163-1172(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share