Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Developmental Biology
Uniprot ID: Q96DR5
Gene Names: BPIFA2
Organism: Homo sapiens (Human)
AA Sequence: ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Expression Region: 19-249aa
Sequence Info: Full Length of Mature Protein
Source: in vitro E.coli expression system
Tag Info: NO-tagged
MW: 25.1 kDa
Alternative Name(s): Parotid secretory protein
Relevance: Has strong antibacterial activity against P. aeruginosa.
Reference: "A member of the PSP/plunc family of BPI proteins is expressed in the human parotid gland." Venkatesh S.G., Geetha C., Gorr S.-U. Submitted (OCT-2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.