Recombinant Human BPI fold-containing family A member 2(BPIFA2)

Recombinant Human BPI fold-containing family A member 2(BPIFA2)

CSB-CF839308HU
Regular price
$821.11 CAD
Sale price
$821.11 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Developmental Biology

Uniprot ID: Q96DR5

Gene Names: BPIFA2

Organism: Homo sapiens (Human)

AA Sequence: ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Expression Region: 19-249aa

Sequence Info: Full Length of Mature Protein

Source: in vitro E.coli expression system

Tag Info: NO-tagged

MW: 25.1 kDa

Alternative Name(s): Parotid secretory protein

Relevance: Has strong antibacterial activity against P. aeruginosa.

Reference: "A member of the PSP/plunc family of BPI proteins is expressed in the human parotid gland." Venkatesh S.G., Geetha C., Gorr S.-U. Submitted (OCT-2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share