Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Developmental Biology
Uniprot ID: Q96DR5
Gene Names: BPIFA2
Organism: Homo sapiens (Human)
AA Sequence: ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Expression Region: 14-249aa
Sequence Info: Full Length of Mature Protein
Source: Yeast
Tag Info: N-terminal 6xHis-sumostar-tagged
MW: 41.1 kDa
Alternative Name(s): Parotid secretory protein
Relevance: Has strong antibacterial activity against P. aeruginosa.
Reference: "Human parotid secretory protein is a lipopolysaccharide-binding protein: identification of an anti-inflammatory peptide domain." Abdolhosseini M., Sotsky J.B., Shelar A.P., Joyce P.B., Gorr S.U. Mol. Cell. Biochem. 359:1-8(2012)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.