Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Cancer
Uniprot ID: Q9NP55
Gene Names: BPIFA1
Organism: Homo sapiens(Human)
AA Sequence: QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
Expression Region: 20-256aa
Sequence Info: Full Length
Source: in vitro E.coli expression system
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 40.7 kDa
Alternative Name(s): Lung-specific protein X Nasopharyngeal carcinoma-related protein Palate lung and nasal epithelium clone protein Secretory protein in upper respiratory tracts Short PLUNC1 Short name: SPLUNC1 Tracheal epithelium-enriched protein Von Ebner protein Hl
Relevance: Plays a role in the innate immune responses of the upper airways. Reduces the surface tension in secretions from airway epithelia and inhibits the formation of biofilm by pathogenic Gram-negative bacteria, such as P.aeruginosa and K.pneumoniae. Binds bacterial lipopolysaccharide (LPS). Negatively regulates proteolytic cleavage of SCNN1G, an event that is required for activation of the epithelial sodium channel (ENaC), and thereby contributes to airway surface liquid homeostasis and proper clearance of mucus. Plays a role in the airway inflammatory response after exposure to irritants. May attract macrophages and neutrophils. May be associated with tumor progression.
Reference: "Isolation of a novel human lung-specific gene, LUNX, a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer."Iwao K., Watanabe T., Fujiwara Y., Takami K., Kodama K., Higashiyama M., Yokouchi H., Ozaki K., Monden M., Tanigami A.Int. J. Cancer 91:433-437(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.