Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-25 working days
Research Topic: Cardiovascular
Uniprot ID: Q02161
Gene Names: RHD
Organism: Homo sapiens (Human)
AA Sequence: LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Expression Region: 388-417aa
Sequence Info: Partial
Source: Mammalian cell
Tag Info: N-terminal GST-tagged
MW: 29.6 kDa
Alternative Name(s): RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240D
Relevance: May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Reference: "Rh(D) antigen expression and isolation of a new Rh(D) cDNA isoform in human erythroleukemic K562 cells." Suyama K., Lunn R., Haller S., Goldstein J. Blood 84:1975-1981(1994)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.