Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Beta-1,4-galactosyltransferase 4(B4GALT4)

Recombinant Human Beta-1,4-galactosyltransferase 4(B4GALT4)

SKU:CSB-CF002516HU

Regular price $2,377.20 CAD
Regular price Sale price $2,377.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O60513

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA

Protein Names:Recommended name: Beta-1,4-galactosyltransferase 4 Short name= Beta-1,4-GalTase 4 Short name= Beta4Gal-T4 Short name= b4Gal-T4 EC= 2.4.1.- Alternative name(s): UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4 UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4 Including the following 2 domains: N-acetyllactosamine synthase EC= 2.4.1.90 Alternative name(s): Nal synthase Lactotriaosylceramide beta-1,4-galactosyltransferase EC= 2.4.1.275 Alternative name(s): Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase

Gene Names:Name:B4GALT4 ORF Names:UNQ552/PRO1109

Expression Region:1-344

Sequence Info:full length protein

View full details