Gene Bio Systems
Recombinant Human Beta-1,3-N-acetylglucosaminyltransferase manic fringe(MFNG)
Recombinant Human Beta-1,3-N-acetylglucosaminyltransferase manic fringe(MFNG)
SKU:CSB-CF013757HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O00587
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR
Protein Names:Recommended name: Beta-1,3-N-acetylglucosaminyltransferase manic fringe EC= 2.4.1.222 Alternative name(s): O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Gene Names:Name:MFNG
Expression Region:1-321
Sequence Info:full length protein
