Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: P35613
Gene Names: BSG
Organism: Homo sapiens (Human)
AA Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
Expression Region: 138-321aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 24.2 kDa
Alternative Name(s): 5F7Collagenase stimulatory factorExtracellular domain matrix metalloproteinase inducer ;EMMPRINLeukocyte activation antigen M6OK blood group antigen;Tumor cell-derived collagenase stimulatory factor ;TCSF; CD147
Relevance: Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to the plasma mbrane. Plays pivotal roles in spermatogenesis, bryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Ses to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.
Reference: Characterization of basigin isoforms and the inhibitory function of basigin-3 in human hepatocellular carcinoma proliferation and invasion.Liao C.G., Kong L.M., Song F., Xing J.L., Wang L.X., Sun Z.J., Tang H., Yao H., Zhang Y., Wang L., Wang Y., Yang X.M., Li Y., Chen Z.N.Mol. Cell. Biol. 31:2591-2604(2011)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.