Recombinant Human B-cell antigen receptor complex-associated protein beta chain(CD79B)

SKU: CSB-CF004958HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P40259

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Protein Names:Recommended name: B-cell antigen receptor complex-associated protein beta chain Alternative name(s): B-cell-specific glycoprotein B29 Ig-beta Immunoglobulin-associated B29 protein CD_antigen= CD79b

Gene Names:Name:CD79B Synonyms:B29, IGB

Expression Region:29-229

Sequence Info:full length protein