Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human ATP-dependent RNA helicase DDX19B(DDX19B) (Active)

Recombinant Human ATP-dependent RNA helicase DDX19B(DDX19B) (Active)

SKU:CSB-EP892352HU

Regular price $879.20 CAD
Regular price Sale price $879.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Signal Transduction

Uniprot NO.:Q9UMR2

Uniprot Entry Name:

Gene Names:DDX19B

Species:Homo sapiens (Human)

Source:E.coli

Expression Region:2-479aa

Sequence:ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

Protein Description:Full Length of Mature Protein

Tag Info:N-terminal GST-tagged

Mol. Weight:80.8 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 ?g/ml can bind human DDX19B, the EC50 of human DDX19B protein is 17.71-23.15 ?g/ml.

Purity:Greater than 85% as determined by SDS-PAGE.

Endotoxin:Not test.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:DEAD box RNA helicase DEAD5 DEAD box protein 19B DBP5, DDX19, TDBP

Relevance:ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19B functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

View full details