Recombinant Human Aquaporin-4(AQP4),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Aquaporin-4(AQP4),partial

CSB-EP001964HU
Regular price
$886.25 CAD
Sale price
$886.25 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Transport

Uniprot ID: P55087

Gene Names: AQP4

Organism: Homo sapiens (Human)

AA Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Expression Region: 253-323aa

Sequence Info: Cytoplasmic Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24 kDa

Alternative Name(s): Mercurial-insensitive water channel ;MIWCWCH4

Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous syst.

Reference: Megalencephalic leukoencephalopathy with subcortical cysts protein 1 functionally cooperates with the TRPV4 cation channel to activate the response of astrocytes to osmotic stress dysregulation by pathological mutations.Lanciotti A., Brignone M.S., Molinari P., Visentin S., De Nuccio C., Macchia G., Aiello C., Bertini E., Aloisi F., Petrucci T.C., Ambrosini E.Hum. Mol. Genet. 21:2166-2180(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share