Gene Bio Systems
Recombinant Human Annexin A4(ANXA4)
Recombinant Human Annexin A4(ANXA4)
SKU:CSB-EP001845HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Cardiovascular
Uniprot ID: P09525
Gene Names: ANXA4
Organism: Homo sapiens (Human)
AA Sequence: ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Expression Region: 2-319aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 55.8 kDa
Alternative Name(s): 35-beta calcimedin Annexin IV Annexin-4 Carbohydrate-binding protein p33/p41 Chromobindin-4 Endonexin I Lipocortin IV P32.5 PP4-X Placental anticoagulant protein II
Relevance: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Reference: "Placental anticoagulant proteins: isolation and comparative characterization four members of the lipocortin family." Tait J.F., Sakata M., McMullen B.A., Miao C.H., Funakoshi T., Hendrickson L.E., Fujikawa K. Biochemistry 27:6268-6276(1988)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
