Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human adenovirus C serotype 6 Early E3B 14.5 kDa protein

Recombinant Human adenovirus C serotype 6 Early E3B 14.5 kDa protein

SKU:CSB-CF529996HWT

Regular price $2,032.80 CAD
Regular price Sale price $2,032.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human adenovirus C serotype 6 (HAdV-6) (Human adenovirus 6)

Uniprot NO.:O55655

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SQTSAPPKRHISCRFTQIWNIPSCYNKQSDLSEAWLYAIISVMVFCSTIFALAIYPYLDI GWNAIDAMNHPTFPAPNVIPLQQVIAPINQPRPPSPTPTEISYFNLTGGDD

Protein Names:Recommended name: Early E3B 14.5 kDa protein

Gene Names:

Expression Region:20-130

Sequence Info:full length protein

View full details