Gene Bio Systems
Recombinant Human adenovirus C serotype 6 Early E3A 11.6 kDa glycoprotein
Recombinant Human adenovirus C serotype 6 Early E3A 11.6 kDa glycoprotein
SKU:CSB-CF523856HWT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human adenovirus C serotype 6 (HAdV-6) (Human adenovirus 6)
Uniprot NO.:O55653
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTGSTIAPTTDYRNTTATGLKSALNLPQVHAFVNDWASLGMWWFSIALMFVCLIIMWLIC CLKRRRARPPIYRPIIVLNPHNEKIHRLDGLKPCSLLLQYD
Protein Names:Recommended name: Early E3A 11.6 kDa glycoprotein
Gene Names:
Expression Region:1-101
Sequence Info:full length protein
