Recombinant Human adenovirus B serotype 35 Early E3 18.5 kDa glycoprotein

SKU: CSB-CF300157HIH

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Human adenovirus B serotype 35 (HAdV-35) (Human adenovirus 35)

Uniprot NO.:P68981

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NYDPCLDFDPENCTLTFAPDTSRICGVLIKCGWECRSVEITHNNKTWNNTLSTTWEPGVPEWYTVSVRGPDGSIRISNNTFIFSEMCDLAMFMSKQYSLWPPSKDNIVTFSIAYCLCACLLTALLCVCIHLLVTTRIKNANNKEKMP

Protein Names:Recommended name: Early E3 18.5 kDa glycoprotein Alternative name(s): E3-19K E3gp 19 kDa Short name= E19 GP19K

Gene Names:

Expression Region:20-166

Sequence Info:full length protein