Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human adenovirus B serotype 3 Early E3 9.0 kDa glycoprotein

Recombinant Human adenovirus B serotype 3 Early E3 9.0 kDa glycoprotein

SKU:CSB-CF319988HIG

Regular price $1,982.40 CAD
Regular price Sale price $1,982.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human adenovirus B serotype 3 (HAdV-3) (Human adenovirus 3)

Uniprot NO.:P11317

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MILFQSNTTTSYAYTNIQPKYAMQLEITILIVIGILILSVILYFIFCRQIPNVHRNSKRR PIYSPMISRPHMALNEI

Protein Names:Recommended name: Early E3 9.0 kDa glycoprotein

Gene Names:

Expression Region:1-77

Sequence Info:full length protein

View full details