Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Acidic fibroblast growth factor intracellular-binding protein(FIBP)

Recombinant Human Acidic fibroblast growth factor intracellular-binding protein(FIBP)

SKU:CSB-EP008671HU

Regular price $992.60 CAD
Regular price Sale price $992.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: O43427

Gene Names: FIBP

Organism: Homo sapiens (Human)

AA Sequence: TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

Expression Region: 2-357aa

Sequence Info: Full Length of Isoform Short

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 57.1 kDa

Alternative Name(s): FGF-1 intracellular-binding protein

Relevance: May be involved in mitogenic function of FGF1.

Reference: Cloning of an intracellular protein that binds selectively to mitogenic acidic fibroblast growth factor.Kolpakova E., Wiedlocha A., Stenmark H., Klingenberg O., Falnes P.O., Olsnes S.Biochem. J. 336:213-222(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details