Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human 5-hydroxytryptamine receptor 2C(HTR2C)

Recombinant Human 5-hydroxytryptamine receptor 2C(HTR2C)

SKU:CSB-CF010889HU

Regular price $2,499.00 CAD
Regular price Sale price $2,499.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P28335

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV

Protein Names:Recommended name: 5-hydroxytryptamine receptor 2C Short name= 5-HT-2C Short name= 5-HT2C Short name= 5-HTR2CAlternative name(s): 5-hydroxytryptamine receptor 1C Short name= 5-HT-1C Short name= 5-HT1C Serotonin receptor 2C

Gene Names:Name:HTR2CSynonyms:HTR1C

Expression Region:33-458

Sequence Info:full length protein

View full details