
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: Q9Y6G3
Gene Names: MRPL42
Organism: Homo sapiens (Human)
AA Sequence: KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
Expression Region: 33-142aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 40.1 kDa
Alternative Name(s): 28S ribosomal protein S32, mitochondrial ;MRP-S32 ;S32mt39S ribosomal protein L31, mitochondrial ;L31mt ;MRP-L31
Relevance:
Reference: Mao Y.F., Peng Y., Dai M., Huang Q.H., Song H., Zhang Q.H., Mao M., Fu G., Luo M., Chen J.H., Hu R. Isolating a new human cDNA.Chen J.H., Luo W.Q., Hu S.N., Li G.T., Jin J., Huang X.W., Zhou H.J., Yuan J.G., Qiang B.Q.Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. , Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.