Gene Bio Systems
Recombinant Human 14KDA phosphohistidine phosphatase(PHPT1)
Recombinant Human 14KDA phosphohistidine phosphatase(PHPT1)
SKU:CSB-YP017942HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Cell Biology
Uniprot ID: Q9NRX4
Gene Names: PHPT1
Organism: Homo sapiens (Human)
AA Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Expression Region: 1-125aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 15.8 kDa
Alternative Name(s): Phosphohistidine phosphatase 1;Protein janus-A homolog
Relevance: Exhibits phosphohistidine phosphatase activity.
Reference: Identification and characterization of a mammalian 14-KDA phosphohistidine phosphatase.Ek P., Pettersson G., Ek B., Gong F., Li J.-P., Zetterqvist O.Eur. J. Biochem. 269:5016-5023(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
