Gene Bio Systems
Recombinant Horse Peripheral myelin protein 22(PMP22)
Recombinant Horse Peripheral myelin protein 22(PMP22)
SKU:CSB-CF018241HO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Equus caballus (Horse)
Uniprot NO.:Q6WL85
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLLLLLGIIVLHVAVLVLLFVATIVSQWIVGNGHATDLWQNCSTTSGNVQHCLSSSANEW LQSVQATMILSIIFSVLSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAASIYTVRH PEWHLDSAYSYGFAYILAWVAFPLALLSGVVYVILRKRE
Protein Names:Recommended name: Peripheral myelin protein 22 Short name= PMP-22
Gene Names:Name:PMP22
Expression Region:1-159
Sequence Info:full length protein
