Recombinant Horse Major allergen Equ c 1

Recombinant Horse Major allergen Equ c 1

CSB-YP839158HO
Regular price
$1,170.00 CAD
Sale price
$1,170.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Allergen

Target / Protein:

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Equus caballus (Horse)

Delivery time: 3-7 business days

Uniprot ID: Q95182

AA Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA

Tag info: N-terminal 6xHis-tagged

Expression Region: 16-187aa

Protein length: Full Length of Mature Protein

MW: 22.1 kDa

Alternative Name(s): Allergen: Equ c 1

Relevance:

Reference: "Biochemical characterization and surfactant properties of horse allergens."Goubran Botros H., Poncet P., Rabillon J., Fontaine T., Laval J.-M., David B.Eur. J. Biochem. 268:3126-3136(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share