Gene Bio Systems
Recombinant His1 virus Putative transmembrane protein ORF17(ORF17)
Recombinant His1 virus Putative transmembrane protein ORF17(ORF17)
SKU:CSB-CF636653HAAR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:His1 virus (isolate Australia/Victoria) (His1V) (Haloarcula hispanica virus 1)
Uniprot NO.:Q25BH8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIDSLTTLMIYFFLPVSYLLVGFVIMYYTREAFKKHMLENMVSPMWQNYVFVMILLIWPF FLFLVVTTTILKLFKAVVN
Protein Names:Recommended name: Putative transmembrane protein ORF17
Gene Names:ORF Names:ORF17
Expression Region:1-79
Sequence Info:full length protein
