>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein:
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Hirudo nipponia (Korean blood-sucking leech)
Delivery time: 3-7 business days
Uniprot ID: P46443
AA Sequence: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA
Tag info: N-terminal 6xHis-tagged
Expression Region: 1-57aa
Protein length: Full Length
MW: 8.1 kDa
Alternative Name(s):
Relevance: Inhibits mammalian elastases.
Reference: "Isolation and characterization of guamerin, a new human leukocyte elastase inhibitor from Hirudo nipponia."Jung H.I., Kim S.I., Ha K.-S., Joe C.O., Kang K.W.J. Biol. Chem. 270:13879-13884(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.