
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: N/A
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Hepatitis delta virus genotype I (isolate Italian) (HDV)
Delivery time: 3-7 business days
Uniprot ID: P06934
AA Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP
Tag info: N-terminal 6xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-195aa
Protein length: Full Length
MW: 25.4 kDa
Alternative Name(s): p24
Relevance: Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome
Reference: "Characterization of hepatitis delta antigen: specific binding to hepatitis delta virus RNA." Lin J.-H., Chang M.F., Baker S.C., Govindarajan S., Lai M.M.C. J. Virol. 64:4051-4058(1990)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.