Recombinant Hepatitis delta virus genotype I Large delta antigen

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Hepatitis delta virus genotype I Large delta antigen

CSB-YP313702HFN
Regular price
$1,263.14 CAD
Sale price
$1,263.14 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P0C6L6

Gene Names: N/A

Organism: Hepatitis delta virus genotype I (isolate Italian) (HDV)

AA Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC

Expression Region: 1-211aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 27.7 kDa

Alternative Name(s): p27

Relevance: Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication

Reference: "Structure, sequence and expression of the hepatitis delta (delta) viral genome." Wang K.S., Choo Q.L., Weiner A.J., Ou J.H., Najarian R.C., Thayer R.M., Mullenbach G.T., Denniston K.J., Gerin J.L., Houghton M. Nature 323:508-514(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share