Gene Bio Systems
Recombinant Helicobacter pylori Flagellar biosynthetic protein FliQ(fliQ)
Recombinant Helicobacter pylori Flagellar biosynthetic protein FliQ(fliQ)
SKU:CSB-CF362980HCQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Helicobacter pylori (strain J99) (Campylobacter pylori J99)
Uniprot NO.:P0A0S4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MESQLMKLAIETYKITLMISLPVLLAGLVVGLLVSIFQATTQINEMTLSFVPKILAVIGV LILTMPWMTNMLLDYTKTLIKLIPKIIG
Protein Names:Recommended name: Flagellar biosynthetic protein FliQ
Gene Names:Name:fliQ Ordered Locus Names:jhp_1314
Expression Region:1-88
Sequence Info:full length protein
