Skip to product information
1 of 1

Gene Bio Systems

Recombinant Helicobacter pylori Acid-activated urea channel(ureI)

Recombinant Helicobacter pylori Acid-activated urea channel(ureI)

SKU:CSB-CF348742HCQ

Regular price $2,157.40 CAD
Regular price Sale price $2,157.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Helicobacter pylori (strain J99) (Campylobacter pylori J99)

Uniprot NO.:P56874

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLGLVLLYVGIVLISNGICGLTKVDPKSTAVMNFFVGGLSIVCNVVVITYSALHPTAPVE GAEDIVQVSHHLTSFYGPATGLLFGFTYLYAAINHTFGLDWRPYSWYSLFVAINTVPAAI LSHYSDMLDDHKVLGITEGDWWAIIWLAWGVLWLTAFIENILKIPLGKFTPWLAIIEGIL TAWIPAWLLFIQHWV

Protein Names:Recommended name: Acid-activated urea channel Alternative name(s): Urease accessory protein UreI

Gene Names:Name:ureI Ordered Locus Names:jhp_0066

Expression Region:1-195

Sequence Info:full length protein

View full details