Recombinant Helianthus annuus  Cytochrome c oxidase subunit 5C-1(COX5C1)

Recombinant Helianthus annuus Cytochrome c oxidase subunit 5C-1(COX5C1)

CSB-CF848740HUO
Regular price
$1,401.00 CAD
Sale price
$1,401.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Helianthus annuus (Common sunflower)

Uniprot NO.:Q8VY40

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVGGRVAHPVLKGPSEVKELIIGSVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVV VQE

Protein Names:Recommended name: Cytochrome c oxidase subunit 5C-1 Alternative name(s): Cytochrome c oxidase polypeptide Vc-1

Gene Names:Name:COX5C1

Expression Region:1-63

Sequence Info:full length protein

Your list is ready to share