Gene Bio Systems
Recombinant Haloquadratum walsbyi Putative metal transport protein HQ3622A(HQ3622A)
Recombinant Haloquadratum walsbyi Putative metal transport protein HQ3622A(HQ3622A)
SKU:CSB-CF619259HAAE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haloquadratum walsbyi (strain DSM 16790)
Uniprot NO.:Q18EC3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ASIVGYAEPLENAAKMTGATDAAMNLNPGVLPDYTVGGFSGPIGTLISAGVGTVLTLIVA FGAGRLLES
Protein Names:Recommended name: Putative metal transport protein HQ3622A
Gene Names:Ordered Locus Names:HQ3622A
Expression Region:33-101
Sequence Info:full length protein
