Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haloquadratum walsbyi Putative metal transport protein HQ3621A(cbiM)

Recombinant Haloquadratum walsbyi Putative metal transport protein HQ3621A(cbiM)

SKU:CSB-CF618267HAAE

Regular price $2,191.00 CAD
Regular price Sale price $2,191.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haloquadratum walsbyi (strain DSM 16790)

Uniprot NO.:Q18EC4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHIPDGFLDPLVAGLFWLGSAVTIGLAVRHARSELGDERTPLLGVVAAGIFAAQMLNWPI PGGTSAHFVGGAFAGILLGPSLGVLAMTAVVTIQALVFGDGGIIALGGNLFAIAVVNVLI GYGLFRMFREIHESGAAFIAGWAAVTLSALIVALGVGFSSAFAYEIGTTVTIMTGGHAVL GIIEGAITAGVYTYIAAARPDLVFTQFENSNLSPDVKL

Protein Names:Recommended name: Putative metal transport protein HQ3621A

Gene Names:Name:cbiM Ordered Locus Names:HQ3621A

Expression Region:1-218

Sequence Info:full length protein

View full details