Gene Bio Systems
Recombinant Halobacterium salinarum Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)
Recombinant Halobacterium salinarum Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)
SKU:CSB-CF888128HTM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Uniprot NO.:Q9HQ63
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSESYDRGLVADFGRWTEFSAGMWAWVFHKFTGWVLVGYLFTHISVLSTSLQGAQVYNST LSGLESLAIVRLLEVGLLAVAVFHILNGIRLLFVDLGVGLEAQDKSFYASLVLTGVIVVA SVPTFLTGAF
Protein Names:Recommended name: Succinate dehydrogenase hydrophobic membrane anchor subunit
Gene Names:Name:sdhD Synonyms:sdhC Ordered Locus Names:VNG_1310G
Expression Region:1-130
Sequence Info:full length protein
