Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haloarcula argentinos Cruxhalorhodopsin-1(choP1)

Recombinant Haloarcula argentinos Cruxhalorhodopsin-1(choP1)

SKU:CSB-CF681489HBAO

Regular price $2,062.20 CAD
Regular price Sale price $2,062.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haloarcula argentinos (Haloarcula sp. (strain arg-1))

Uniprot NO.:Q53461

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:PMILLALGLLADTDIASLFTAITMDIGMCVTGLAAALITSSHLLRWVFYGISCAFFVAVL YVLLVQWPADAEAAGTSEIFGTLKILTVVLWLGYPILWALGSEGVALLSVGVTSWGYSGL DILAKYVFAFI

Protein Names:Recommended name: Cruxhalorhodopsin-1 Short name= CHR-1

Gene Names:Name:choP1

Expression Region:1-131

Sequence Info:full length protein

View full details