Gene Bio Systems
Recombinant Hahella chejuensis UPF0060 membrane protein HCH_03337(HCH_03337)
Recombinant Hahella chejuensis UPF0060 membrane protein HCH_03337(HCH_03337)
SKU:CSB-CF651802HAAI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Hahella chejuensis (strain KCTC 2396)
Uniprot NO.:Q2SGY2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALLKITLLFAVTAITEIVGCYLPWLVIKQGKSLWLLVPAALSLAIFAWLLTLHPTAAGR TYAAYGGMYVVVALIWLHFVEGVGLTRFDFLGATMALAGMAIIALQPISHS
Protein Names:Recommended name: UPF0060 membrane protein HCH_03337
Gene Names:Ordered Locus Names:HCH_03337
Expression Region:1-111
Sequence Info:full length protein
