Gene Bio Systems
Recombinant Haemophilus parasuis serovar 5 UPF0756 membrane protein HAPS_1649 (HAPS_1649)
Recombinant Haemophilus parasuis serovar 5 UPF0756 membrane protein HAPS_1649 (HAPS_1649)
SKU:CSB-CF493128HTD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus parasuis serovar 5 (strain SH0165)
Uniprot NO.:B8F792
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLQFNSVALLLVALILLGIFSQNSAVTISAAVLLIMQQTLLSKYVPYLEQYGIKIGIII LTIGVLAPLVSGRIALPELVQLINWKMIVAIIAGIVVAWLGGRGVTLMGNQPVLVTGLLI GTIIGVAFLKGVPVGPLIAAGILSLIIGKS
Protein Names:Recommended name: UPF0756 membrane protein HAPS_1649
Gene Names:Ordered Locus Names:HAPS_1649
Expression Region:1-150
Sequence Info:full length protein
