Recombinant Haemophilus influenzae  UPF0382 membrane protein HI_1073 (HI_1073)

Recombinant Haemophilus influenzae UPF0382 membrane protein HI_1073 (HI_1073)

CSB-CF338032HTA
Regular price
$1,466.00 CAD
Sale price
$1,466.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Uniprot NO.:P45019

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNKYLTLVALSGFFCVALGAFAAHGLSHILEAKALSWIDTGLEYQMFHTIAVLAVALSA LRDNKFARLSMSSWLIGILLFSGSLYALAFEASNVIVWITPIGGTLFLIGWISLAYGSFK SKSL

Protein Names:Recommended name: UPF0382 membrane protein HI_1073

Gene Names:Ordered Locus Names:HI_1073

Expression Region:1-124

Sequence Info:full length protein

Your list is ready to share