Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae UPF0299 membrane protein NTHI1827(NTHI1827)

Recombinant Haemophilus influenzae UPF0299 membrane protein NTHI1827(NTHI1827)

SKU:CSB-CF683870HAAA

Regular price $2,076.20 CAD
Regular price Sale price $2,076.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain 86-028NP)

Uniprot NO.:Q4QK50

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIQKLFLLVRSLVILSIMLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRRENQVKQAN

Protein Names:Recommended name: UPF0299 membrane protein NTHI1827

Gene Names:Ordered Locus Names:NTHI1827

Expression Region:1-140

Sequence Info:full length protein

View full details