Gene Bio Systems
Recombinant Grosmannia clavigera Signal peptidase complex catalytic subunit SEC11(SEC11)
Recombinant Grosmannia clavigera Signal peptidase complex catalytic subunit SEC11(SEC11)
SKU:CSB-CF516799GHF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Grosmannia clavigera (strain kw1407 / UAMH 11150) (Blue stain fungus) (Graphiocladiella clavigera)
Uniprot NO.:F0XJH4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSAVAKPRQLASQILNFGLILSTAFMIWKGLSVVSDSSSPIVVVLSGSMEPAFQRGDLL FLWNRNLLQETDVGEIVVYNVRGKDIPIVHRIVRKFGTGPHAKLLTKGDNNAGDDTDLYA QGQDYLERKDIVGSVVGYVPFVGYVTILLTEHPWLKKVMLGLMGVLVVLQRE
Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I
Gene Names:Name:SEC11 ORF Names:CMQ_2301
Expression Region:1-172
Sequence Info:full length protein
