Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gossypium hirsutum Chlorophyll a-b binding protein 151, chloroplastic(CAB-151)

Recombinant Gossypium hirsutum Chlorophyll a-b binding protein 151, chloroplastic(CAB-151)

SKU:CSB-CF333266GHB

Regular price $1,970.00 CAD
Regular price Sale price $1,970.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)

Uniprot NO.:P27518

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RRTVKSAPTSIWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNREL EVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSI LAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNG RLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 151, chloroplastic Alternative name(s): LHCII type II CAB-151 Short name= LHCP

Gene Names:Name:CAB-151

Expression Region:38-265

Sequence Info:full length protein

View full details